SMART: Pfam domain RFXA_RFXANK

The domain within your query sequence starts at position 100 and ends at position 226; the E-value for the RFXA_RFXANK_bdg domain shown below is 6.5e-64.

TCTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSAASTGNVKLE
ESTDNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVL
EQRQQHF

RFXA_RFXANK_bdg

PFAM accession number:	PF15289
Interpro abstract (IPR029316):	This C-terminal domain of Regulatory factor X-associated protein (RFXAP) binds to RFXANK [ (PUBMED:9118943) (PUBMED:10072068) ], the ankyrin-repeat regulatory factor X protein. RFXAP is part of the RFX complex, mutants of either RFXAP or RFXANK protein fail to bind to each other. RFX5 binds only to the RFXANK-RFXAP scaffold and not to either protein alone, and neither the scaffold nor RFX5 alone can bind DNA. The binding of the RFXANK-RFXAP scaffold to RFX5 leads to a conformational change in the latter that exposes the DNA-binding domain of RFX5. The DNA-binding domain of RFX5 anchors the RFX complex to MHC class II X and S promoter boxes [ (PUBMED:10825209) ].

PFAM accession number:

PF15289

Interpro abstract (IPR029316):

This C-terminal domain of Regulatory factor X-associated protein (RFXAP) binds to RFXANK [ (PUBMED:9118943) (PUBMED:10072068) ], the ankyrin-repeat regulatory factor X protein. RFXAP is part of the RFX complex, mutants of either RFXAP or RFXANK protein fail to bind to each other. RFX5 binds only to the RFXANK-RFXAP scaffold and not to either protein alone, and neither the scaffold nor RFX5 alone can bind DNA. The binding of the RFXANK-RFXAP scaffold to RFX5 leads to a conformational change in the latter that exposes the DNA-binding domain of RFX5. The DNA-binding domain of RFX5 anchors the RFX complex to MHC class II X and S promoter boxes [ (PUBMED:10825209) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFXA_RFXANK_bdg