The domain within your query sequence starts at position 4 and ends at position 124; the E-value for the RFamide_26RFa domain shown below is 1.4e-55.
FRPLLSLLLPLSACFPLLDRRGPTDIGDIGARMNWAQLAEGHPPNSVQNPQPQALLVVAR EQQASHREHTGFRLGRQDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRFG R
RFamide_26RFa |
---|
PFAM accession number: | PF11109 |
---|---|
Interpro abstract (IPR024565): | QRFP/P518 has a direct role in maintaining bone mineral density [ (PUBMED:17869477) ]. QRFP has also found to be important in energy homeostasis by regulating appetite and energy expenditure in mice [ (PUBMED:16543370) ]. The C-terminal 28 residues are the functional neuropeptide 26RFa [ (PUBMED:14657341) ]. |
GO function: | orexigenic neuropeptide QRFP receptor binding (GO:0031854) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RFamide_26RFa