The domain within your query sequence starts at position 223 and ends at position 389; the E-value for the RGM_C domain shown below is 4.7e-59.
CIDQKVYQAEVDNLPAAFEDGSINGGDRPGGSSLSIQTANLGSHVEIRAAYIGTTIIIRQ TAGQLSFSIRVAEDVARAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKE GLPVEDAYFQSCVFDVSVSGDPNFTVAAQTALDDARIFLTDLENLHL
RGM_C |
---|
PFAM accession number: | PF06534 |
---|---|
Interpro abstract (IPR009496): | This entry contains of several mammalian and one bird sequence from Gallus gallus (Chicken) and represents the C-terminal region of several sequences, but in others it represents the full protein. All of the mammalian proteins are hypothetical and have no known function, but Q8JG54 from the chicken is annotated as being a repulsive guidance molecule (RGM). RGM is a GPI-linked axon guidance molecule of the retinotectal system. RGM is repulsive for a subset of axons, those from the temporal half of the retina. Temporal retinal axons invade the anterior optic tectum in a superficial layer, and encounter RGM expressed in a gradient with increasing concentration along the anterior-posterior axis. Temporal axons are able to receive posterior-dependent information by sensing gradients or concentrations of guidance cues. Thus, RGM is likely to provide positional information for temporal axons invading the optic tectum in the stratum opticum [ (PUBMED:12353034) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RGM_C