The domain within your query sequence starts at position 421 and ends at position 479; the E-value for the RHIM domain shown below is 2.3e-10.

PPNLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDV

RHIM

RHIM
PFAM accession number:PF12721
Interpro abstract (IPR025735):

RIP proteins are receptor-interacting serine/threonine-protein kinases or cell death proteins [ (PUBMED:11734559) ]. The RHIM (RIP homotypic interaction motif) domain is involved in virus recognition. It is necessary for the recruitment of RIP and RIP3 by the IFN-inducible protein DNA-dependent activator of IRFs (DAI), also known as DLM-1 or Z-DNA binding protein (ZBP1). Both RIP kinases contribute to DAI-induced NF-kappaB activation. RIP3 undergoes auto phosphorylation on binding to DAI [ (PUBMED:19590578) ].

The RHIM domain is also located at the C terminus of TIR-domain-containing adapter-inducing IFN-beta (TRIF). It is essential for TRIF-induced apoptosis, and has been shown to contribute to TRIF-induced NF-kappaB activation [ (PUBMED:15814722) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RHIM