SMART: Pfam domain RIC3

The domain within your query sequence starts at position 15 and ends at position 165; the E-value for the RIC3 domain shown below is 3.9e-52.

LVLAVSLLLPKAFLSRGKRPEPPPGPEGKLDRFPPMMHHHSAPSDGQTPGARFQRSHLAE
AFAKAKGAGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTAEDRNCSTAPP
GNAHRKITNFELVQLQEKLKETEEAMEKLIN

RIC3

PFAM accession number:	PF15361
Interpro abstract (IPR032763):	This entry represents the N-terminal domain of RIC3, a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems [ (PUBMED:11867529) (PUBMED:12821669) ]. It can enhance functional expression of multiple nAChR subtypes [ (PUBMED:16120769) ]. RIC3 promotes functional expression of homomeric alpha-7 and alpha-8 nicotinic acetylcholine receptors at the cell surface [ (PUBMED:15809299) ].

PFAM accession number:

PF15361

Interpro abstract (IPR032763):

This entry represents the N-terminal domain of RIC3, a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems [ (PUBMED:11867529) (PUBMED:12821669) ]. It can enhance functional expression of multiple nAChR subtypes [ (PUBMED:16120769) ]. RIC3 promotes functional expression of homomeric alpha-7 and alpha-8 nicotinic acetylcholine receptors at the cell surface [ (PUBMED:15809299) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RIC3