The domain within your query sequence starts at position 3829 and ends at position 3947; the E-value for the RIH_assoc domain shown below is 3.1e-36.

LQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFY
WYYSGKDIIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFL

RIH_assoc

RIH_assoc
PFAM accession number:PF08454
Interpro abstract (IPR013662):

This eukaryotic domain is found in ryanodine receptors (RyR) and inositol 1, 4, 5-trisphosphate receptors (IP3R) which together form a superfamily of homotetrameric ligand-gated intracellular Ca2+ channels [(PUBMED:14516409)]. There seems to be no known function for this domain [(PUBMED:10664581)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RIH_assoc