The domain within your query sequence starts at position 77 and ends at position 136; the E-value for the RILP domain shown below is 2.1e-27.

TLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHPRTSPQPESGIK

RILP

RILP
PFAM accession number:PF11461
Interpro abstract (IPR021563):

Rab interacting lysosomal protein (RILP) contains a domain which contains two coiled-coil regions and is found mainly in the cytosol. RILP is recruited onto late endosomal and lysosomal membranes by Rab7 and acts as a downstream effector of Rab7 [(PUBMED:15933719)]. This recruitment process is important for phagosome maturation and fusion with late endosomes and lysosomes.

GO function:protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RILP