The domain within your query sequence starts at position 536 and ends at position 773; the E-value for the RINT1_TIP1 domain shown below is 3.1e-11.

STDEAKLSFLVTLNNVEVCSENISTLKKTLESDCTKLFSQGIGGEQAQAKFDSCLSDLAA
VSNKFRDLLQEGLAELNSSAVKPQVQPWINTFLSVSHSIEEEEFNDYEANDPWVQQFILN
LEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYL
TTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRI

RINT1_TIP1

RINT1_TIP1
PFAM accession number:PF04437
Interpro abstract (IPR007528):

This entry includes PINT-1 from animals, Tip20 from yeasts and MAIGO2 (Mag2) from plants. They play a role in anterograde transport from the endoplasmic reticulum (ER) to the Golgi and/or retrograde transport from the Golgi to the ER share sequence similarity. They share a similar domain organisation with an N-terminal leucine heptad repeat rich coiled coil and an ~500-residue C-terminal RINT1/TIP20 domain, which might be a protein-protein interaction module necessary for the formation of functional complexes.

RINT-1 interacts with Rad50 only during late S and G2/M phases and participates in radiation induced checkpoint control [(PUBMED:11096100)]. RINT-1 also functions in membrane trafficking from the endoplasmic reticulum(ER) to the Golgi complex in interphase cells [(PUBMED:11096100), (PUBMED:16600870), (PUBMED:16571679)].

Tip20 is involved in the retrograde transport from the Golgi to the ER [(PUBMED:19151722), (PUBMED:8334998)].

Arabidopsis Mag2 functions in the transport of storage protein precursors between the ER and Golgi complex in plants [(PUBMED:17194767)].

GO process:Golgi vesicle transport (GO:0048193)
GO component:endoplasmic reticulum (GO:0005783)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RINT1_TIP1