The domain within your query sequence starts at position 1 and ends at position 253; the E-value for the RITA domain shown below is 2.5e-105.

MKALHLQHRSPTSYRVKARASYVDETLFGSPARTRPAQPDFDPPWVQNCNRSRGVGPGPP
KGSLAKRDCESPSSRGSTPNLTPRKKNKYRLIGHAPSYCDESLFGTSKEGSRMAVGDAAK
LRTLFWTPPATPRGSHTPCPRETPLRAIHPAGPSRTEPRVTAGSQMSSQDGLCVPCSLGQ
RRSHSLTHLTVPSTGHPASSAPQTNGPWSPRPNTSGATVQSPLVTSKACSGRVSGPAPPR
RGACPPKPKPPWK

RITA

RITA
PFAM accession number:PF17066
Interpro abstract (IPR031418):

RITA (RBPJ-interacting and tubulin-associated protein) is a highly conserved protein that binds to tubulin and shuttles between the cytoplasm and nucleus. It is responsible for export of RBP-J/CBF-1 from the nucleus, which modulates Notch-mediated transcription [(PUBMED:21102556)].

GO process:nuclear export (GO:0051168), Notch signaling pathway (GO:0007219)
GO function:tubulin binding (GO:0015631)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RITA