The domain within your query sequence starts at position 63 and ends at position 163; the E-value for the RIX1 domain shown below is 2.3e-9.

APHLPGLMCLLRLHGTAGGAQNLSALGALVNLSNAHLGSIKTRFEGLCLLSLLIGESPTE
LFQQHCVSWLRSIQQVLQVLLNFPESPETPEFQGGCISNLE

RIX1

RIX1
PFAM accession number:PF08167
Interpro abstract (IPR012583):

Rix1 is a nucleoplasmic particle involved in rRNA processing/ribosome assembly [(PUBMED:1511223), (PUBMED:12374754)]. It associates with two other proteins, Ipi1 and Ipi3, to form the RIX1 complex that allows Rea1 - the AAA ATPase - to associate with the 60S ribosomal subunit. More than 170 assembly factors are involved in the construction and maturation of yeast ribosomes, and after these factors have completed their function they need to be released from the pre-ribosomes. Rea1 induces the release of the assembly protein complex in a mechanical fashion [(PUBMED:19737511)]. This family is usually associated with NUC202.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RIX1