The domain within your query sequence starts at position 58 and ends at position 92; the E-value for the RLI domain shown below is 8.2e-17.

CALAMWELGHCDPKRCTGRKLARLGLVRCLRLSQR

RLI

RLI
PFAM accession number:PF04068
Interpro abstract (IPR007209): This is part of a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, IPR017896. Also often found adjacent to IPR007177 in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [(PUBMED:9524254)], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [(PUBMED:7539425)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RLI