SMART: Pfam domain RLI

The domain within your query sequence starts at position 6 and ends at position 37; the E-value for the RLI domain shown below is 6.9e-18.

TRIAIVNHDKCKPKKCRQECKKSCPVVRMGKL

RLI

PFAM accession number:	PF04068
Interpro abstract (IPR007209):	This is part of a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, IPR017896 . Also often found adjacent to IPR007177 in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [ (PUBMED:9524254) ], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [ (PUBMED:7539425) ].

PFAM accession number:

PF04068

Interpro abstract (IPR007209):

This is part of a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, IPR017896 . Also often found adjacent to IPR007177 in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [ (PUBMED:9524254) ], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [ (PUBMED:7539425) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RLI