The domain within your query sequence starts at position 6 and ends at position 37; the E-value for the RLI domain shown below is 6.9e-18.
TRIAIVNHDKCKPKKCRQECKKSCPVVRMGKL
RLI |
---|
PFAM accession number: | PF04068 |
---|---|
Interpro abstract (IPR007209): | This is part of a possible metal-binding domain in endoribonuclease RNase L inhibitor. It is found at the N-terminal end of RNase L inhibitor proteins, adjacent to the 4Fe-4S binding domain, IPR017896 . Also often found adjacent to IPR007177 in uncharacterised proteins. The RNase L system plays a major role in the anti-viral and anti-proliferative activities of interferons [ (PUBMED:9524254) ], and could possibly play a more general role in the regulation of RNA stability in mammalian cells. Inhibitory activity requires concentration-dependent association of RLI with RNase L [ (PUBMED:7539425) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RLI