The domain within your query sequence starts at position 479 and ends at position 614; the E-value for the RMI1_C domain shown below is 4.2e-45.

SPPFIYLSVLMARKPKEVTTVTVKAFIVTLTGNLSSSGGFWGVTAKVSDGTAYLDVDFID
EILTSMIGYSVPEMKQLRKDPLKYKTFLEGLQKCQRDLIDLCCLMTISYDPSSCKGVVLE
LQDVGMEHVENLKKRL

RMI1_C

RMI1_C
PFAM accession number:PF16099
Interpro abstract (IPR032199):

The dissolvasome is a protein complex that consists of BLM, a RecQ helicase that is product of the gene mutated in Bloom syndrome, topoisomerase IIIalpha (Top3alpha) and the RMI (RecQ-mediated genome instability) subcomplex, comprised of RMI1 and RMI2. The dissolvasome acts on double Holliday junction intermediates in homologous recombination, creating non-crossover products in a process termed 'dissolution' [(PUBMED:14685245), (PUBMED:16537486)].

This entry represents the C-terminal oligo-nucleotide binding domain of Recq-mediated genome instability protein RMI1. This domain interacts with RMI2-OB folds to make up the RMI core complex. The RMI core interface is crucial for dissolvasome assembly and may have additional cellular roles as a docking hub for other proteins [(PUBMED:18923082), (PUBMED:20826341)].

GO function:nucleotide binding (GO:0000166)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RMI1_C