SMART: Pfam domain RMI2

The domain within your query sequence starts at position 23 and ends at position 145; the E-value for the RMI2 domain shown below is 4.3e-46.

PPLKVLAGQLRRHAEGGPGAWRLSRAAVGRAPLELVAVWMQGTVLAAEGGQARLRDSSGA
FSVRGLERVPRGRPCLLPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPVHESMWELEVE
DLH

RMI2

PFAM accession number:	PF16100
Interpro abstract (IPR032245):	The dissolvasome is a protein complex that consists of BLM, a RecQ helicase that is product of the gene mutated in Bloom syndrome, topoisomerase IIIalpha (Top3alpha) and the RMI (RecQ-mediated genome instability) subcomplex, comprised of RMI1 and RMI2. The dissolvasome acts on double Holliday junction intermediates in homologous recombination, creating non-crossover products in a process termed 'dissolution' [ (PUBMED:14685245) (PUBMED:16537486) ]. RMI2 is an OB3, oligo-nucleotide-binding protein. It is an essential component of the RMI complex [ (PUBMED:20826341) ].

PFAM accession number:

PF16100

Interpro abstract (IPR032245):

The dissolvasome is a protein complex that consists of BLM, a RecQ helicase that is product of the gene mutated in Bloom syndrome, topoisomerase IIIalpha (Top3alpha) and the RMI (RecQ-mediated genome instability) subcomplex, comprised of RMI1 and RMI2. The dissolvasome acts on double Holliday junction intermediates in homologous recombination, creating non-crossover products in a process termed 'dissolution' [ (PUBMED:14685245) (PUBMED:16537486) ].

RMI2 is an OB3, oligo-nucleotide-binding protein. It is an essential component of the RMI complex [ (PUBMED:20826341) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RMI2