The domain within your query sequence starts at position 376 and ends at position 418; the E-value for the RMMBL domain shown below is 1.1e-16.

QMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAK

RMMBL

RMMBL
PFAM accession number:PF07521
Interpro abstract (IPR011108):

The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 and are common to all metallo-beta-lactamases. This, the fifth motif [(PUBMED:12177301)], appears to be specific to Zn-dependent metallohydrolases such as ribonuclease J 2 [(PUBMED:21764917)] which are involved in the processing of mRNA [(PUBMED:17128255), (PUBMED:20544974)]. This domain adds essential structural elements to the CASP-domain and is unique to RNA/DNA-processing nucleases, showing that they are pre-mRNA 3'-end-processing endonucleases [(PUBMED:17128255), (PUBMED:20544974), (PUBMED:21764917)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RMMBL