The domain within your query sequence starts at position 64 and ends at position 210; the E-value for the RMP domain shown below is 1.3e-59.
LDSLINEIFEEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTN TSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFSRNNMPEFHKLKTKLIEKKGARAYA CQCSWRTVEELTDLQTDHQLRWVCGKH
RMP |
---|
PFAM accession number: | PF14996 |
---|---|
Interpro abstract (IPR029239): | C8orf37 encodes a ciliary protein. In humans, mutations in C8orf37 cause two types of retinal dystrophies: cone-rod dystrophy type 16 (CORD16) and retinitis pigmentosa type 64 (RP64). CORD16 affects the cone receptors which detect red, green or blue wavelengths of light, and RP64 affects the cone receptors first and then the rod receptors. Both of these affect the photo-receptors in the eye leading to colour blindness or blindness respectively [ (PUBMED:22177090) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RMP