The domain within your query sequence starts at position 49 and ends at position 431; the E-value for the RNA_pol_I_A49 domain shown below is 1.4e-117.

QNPGDMRFTLYNSTDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCRHFVGILN
KTSGQMEVYDAELFNMQPLFADDAIEREPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNS
RRMNKVGSESLNLSVAKAAESIIDTKGVNALVSDAMQDDLQDGVLYLPPCYADAAKPEDV
YRFEDILSPAEYDALESPSEAFRKVTSEDILKMIEENSHCSYVIEMLKSLPIDEVHRNRQ
ARSIWFLDALIRFRAQKVIKGKRALGPGIPHIINTKLLKQFTCLTYNNGRLQNLISSSMR
AKITSYAIILALHINNFQVDLTALQKDLKLSEKRMIEIAKAMRLKISKQKVSLADGREES
HRLGTLSVPLPPAQNSDRQSKRR

RNA_pol_I_A49

RNA_pol_I_A49
PFAM accession number:PF06870
Interpro abstract (IPR009668):

Saccharomyces cerevisiae A49 is a specific subunit associated with RNA polymerase I (Pol I) in eukaryotes. Pol I maintains transcription activities in A49 deletion mutants. However, such mutants are deficient in transcription activity at low temperatures. Deletion analysis of the fusion yeast homologue indicates that only the C-terminal two thirds are required for function. Transcript analysis has demonstrated that A49 is maximising transcription of ribosomal DNA [(PUBMED:12893961)].

GO process:transcription, DNA-templated (GO:0006351)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_I_A49