The domain within your query sequence starts at position 30 and ends at position 104; the E-value for the RNA_pol_L_2 domain shown below is 5.3e-32.

ACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTN
AITDLISELSLLEER

RNA_pol_L_2

RNA_pol_L_2
PFAM accession number:PF13656
Interpro abstract (IPR009025):

RNA polymerase (RNAP) II, which is responsible for all mRNA synthesis in eukaryotes, consists of 12 subunits. Subunits Rpb3 and Rpb11 form a heterodimer that is functionally analogous to the archaeal RNAP D/L heterodimer, and the prokaryotic RNAP alpha subunit homodimer. In each case, they play a key role in RNAP assembly by forming a platform on which the catalytic subunits (eukaryotic Rpb1/Rpb2, and prokaryotic beta/beta') can interact [ (PUBMED:11453250) ]. These different subunits share regions of homology. Rpb11 contains a domain (Rpb11-like domain) that is required for dimerisation, and binds to a homologous region on Rpb3. The Rpb11-like domain in Rpb11 and archaeal L subunits is contiguous, whereas in Rpb3, archaeal D, and prokaryotic alpha subunits ( IPR011263 ), the Rpb11-like domain is interrupted by an insert domain ( IPR011262 ). In the prokaryotic RNAP alpha subunit, the Rpb11-like domain and the insert domain form two subregions of the N-terminal domain.

The structure of the Rpb11-like domain consists of a two-layer alpha/beta fold consisting of beta(2)-alpha-beta(2)-alpha. Rpb3 and Rpb11 in yeast RNAP [ (PUBMED:11313498) (PUBMED:12191485) ] have been shown to share a high degree of sequence and structural similarity to the alpha subunit of bacterial RNAP [ (PUBMED:9657722) (PUBMED:12000971) ].

GO process:transcription, DNA-templated (GO:0006351)
GO function:protein dimerization activity (GO:0046983)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_L_2