The domain within your query sequence starts at position 563 and ends at position 621; the E-value for the RNA_pol_Rpa2_4 domain shown below is 4.1e-23.

VGWVDKDLAPEVADTLRRFKVLREKRIPPWMEVALIPMTGKPSLYPGLFLFTTPCRLVR

RNA_pol_Rpa2_4

RNA_pol_Rpa2_4
PFAM accession number:PF06883
Interpro abstract (IPR009674):

This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [(PUBMED:11313498)].

GO process:transcription, DNA-templated (GO:0006351)
GO component:nucleus (GO:0005634)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpa2_4