The domain within your query sequence starts at position 841 and ends at position 1318; the E-value for the RNA_pol_Rpb1_5 domain shown below is 1.2e-92.

GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVYPCQTEPALSKNDLTLTAEAIMKKNEFLC
CQDSFLQEIKTFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLML

RNA_pol_Rpb1_5

RNA_pol_Rpb1_5
PFAM accession number:PF04998
Interpro abstract (IPR007081): RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain, domain 5, represents the discontinuous cleft domain that is required to form the central cleft or channel where the DNA is bound [(PUBMED:8910400), (PUBMED:11313498)].
GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb1_5