The domain within your query sequence starts at position 1164 and ends at position 1299; the E-value for the RNA_pol_Rpb1_7 domain shown below is 1.4e-55.
TTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTD RKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDV FLRCIESNMLTDMTLQ
RNA_pol_Rpb1_7 |
![]() |
---|
PFAM accession number: | PF04990 |
---|---|
Interpro abstract (IPR007073): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain, domain 7, represents a mobile module of the RNA polymerase. Domain 7 interacts with the lobe domain of Rpb2 ( IPR007642 ) [ (PUBMED:8910400) (PUBMED:11313498) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO function: | DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb1_7