The domain within your query sequence starts at position 38 and ends at position 413; the E-value for the RNA_pol_Rpb2_1 domain shown below is 2e-55.

GLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPV
SPHECRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAK
LNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMA
VKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQI
FTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAV
MVRRVILAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRA
AQFDVVKHMRQDQITN

RNA_pol_Rpb2_1

RNA_pol_Rpb2_1
PFAM accession number:PF04563
Interpro abstract (IPR007644):

RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain forms one of the two distinctive lobes of the Rpb2 structure. This domain is also known as the protrusion domain [(PUBMED:3116266)]. The other lobe, RNA polymerase Rpb2, domain 2, is nested within this domain.

GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_1