The domain within your query sequence starts at position 185 and ends at position 363; the E-value for the RNA_pol_Rpb2_2 domain shown below is 8.4e-29.

SKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMG
VESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGGPKKT
KIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNKRLE

RNA_pol_Rpb2_2

RNA_pol_Rpb2_2
PFAM accession number:PF04561
Interpro abstract (IPR007642):

RNA polymerases catalyse the DNA-dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Rpb2 is the second largest subunit of the RNA polymerase. This domain forms one of the two distinctive lobes of the Rpb2 structure. It is also known as the lobe domain [(PUBMED:11313498)]. DNA has been demonstrated to bind to the concave surface of the lobe domain, and plays a role in maintaining the transcription bubble. Many of the bacterial members contain large insertions within this domain, a region known as dispensable region 1 (DRI).

GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_2