The domain within your query sequence starts at position 455 and ends at position 521; the E-value for the RNA_pol_Rpb2_3 domain shown below is 1.4e-28.

VVADKLNFLRYLSHFRCVHRGAAFAKMRTTTVRRLLPESWGFLCPVHTPDGAPCGLLNHL
TAVCEVV

RNA_pol_Rpb2_3

RNA_pol_Rpb2_3
PFAM accession number:PF04565
Interpro abstract (IPR007645): RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 3, is also known as the fork domain and is proximal to catalytic site [(PUBMED:11313498)].
GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_3