The domain within your query sequence starts at position 539 and ends at position 600; the E-value for the RNA_pol_Rpb2_4 domain shown below is 1e-29.

VFLNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYII
VK

RNA_pol_Rpb2_4

RNA_pol_Rpb2_4
PFAM accession number:PF04566
Interpro abstract (IPR007646): RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 4 is also known as the external 2 domain [(PUBMED:11313498)].
GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_4