The domain within your query sequence starts at position 621 and ends at position 661; the E-value for the RNA_pol_Rpb2_5 domain shown below is 6.5e-14.

FEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIEP

RNA_pol_Rpb2_5

RNA_pol_Rpb2_5
PFAM accession number:PF04567
Interpro abstract (IPR007647):

RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 5 is also known as the external 2 domain [ (PUBMED:11313498) ].

GO process:transcription, DNA-templated (GO:0006351)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_5