The domain within your query sequence starts at position 668 and ends at position 1041; the E-value for the RNA_pol_Rpb2_6 domain shown below is 5.8e-129.

CAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIEL
IDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTF
DKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQ
QPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVC
GLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS
KVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGP
RAVLTRQPTEGRSR

RNA_pol_Rpb2_6

RNA_pol_Rpb2_6
PFAM accession number:PF00562
Interpro abstract (IPR007120):

RNA polymerases (EC 2.7.7.6) catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain represents the hybrid-binding domain and the wall domain [(PUBMED:11313498)]. The hybrid-binding domain binds the nascent RNA strand/template DNA strand in the Pol II transcription elongation complex. This domain contains the important structural motifs, switch 3 and the flap loop and binds an active site metal ion [(PUBMED:11313498)]. This domain is also involved in binding to Rpb1 and Rpb3 [(PUBMED:11313498)]. Many of the bacterial members contain large insertions within this domain, which are known as dispensable region 2 (DRII).

GO process:transcription, DNA-templated (GO:0006351)
GO function:DNA-directed 5'-3' RNA polymerase activity (GO:0003899), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_6