The domain within your query sequence starts at position 1082 and ends at position 1174; the E-value for the RNA_pol_Rpb2_7 domain shown below is 3.3e-35.
GGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCR NKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
RNA_pol_Rpb2_7 |
 |
|---|
| PFAM accession number: | PF04560 |
|---|---|
| Interpro abstract (IPR007641): | RNA polymerases catalyse the DNA-dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Rpb2 is the second largest subunit of the RNA polymerase. This domain comprised of the structural domains anchor and clamp. The clamp region (C-terminal) contains a zinc-binding motif. The clamp region is named due to its interaction with the clamp domain found in Rpb1. The domain also contains a region termed switch 4. The switches within the polymerase are thought to signal different stages of transcription [ (PUBMED:11313498) ]. |
| GO process: | transcription, DNA-templated (GO:0006351) |
| GO function: | DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_7