The domain within your query sequence starts at position 263 and ends at position 389; the E-value for the RNA_pol_Rpc4 domain shown below is 7.9e-33.

DEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADLT
EGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHK
LVCSPDF

RNA_pol_Rpc4

RNA_pol_Rpc4
PFAM accession number:PF05132
Interpro abstract (IPR007811): This entry represents a component of the RNA polymerase III (Pol III) complex which catalyse the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates [(PUBMED:19631370)].
GO process:transcription by RNA polymerase III (GO:0006383)
GO component:DNA-directed RNA polymerase III complex (GO:0005666)
GO function:DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpc4