The domain within your query sequence starts at position 2 and ends at position 238; the E-value for the RNF111_N domain shown below is 3.9e-46.

KMEEAVGKVEELIESAAPPKASEQETAKEEDGSVELESQVQKDGVADSTVLSSMPCLLME
LRRDSSESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSVEENEPSQAE
TTVEGDTSGVSGATVGRKSRRSRSESETSTMAAKKNRQSSDKQNGRVTKVKGHRSQKHKE
RIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTSSSDDDDEVSGSSKTITAEIP

RNF111_N

RNF111_N
PFAM accession number:PF15303
Interpro abstract (IPR029306):

This domain is found at the N terminus of E3 ubiquitin-protein ligase Arkadia. Arkadia plays a role in embryonic development [(PUBMED:11298452)]. Proteins containing this domain also include protein C18orf25 from humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNF111_N