The domain within your query sequence starts at position 2 and ends at position 238; the E-value for the RNF111_N domain shown below is 3.9e-46.
KMEEAVGKVEELIESAAPPKASEQETAKEEDGSVELESQVQKDGVADSTVLSSMPCLLME LRRDSSESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSVEENEPSQAE TTVEGDTSGVSGATVGRKSRRSRSESETSTMAAKKNRQSSDKQNGRVTKVKGHRSQKHKE RIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTSSSDDDDEVSGSSKTITAEIP
RNF111_N |
---|
PFAM accession number: | PF15303 |
---|---|
Interpro abstract (IPR029306): | This domain is found at the N terminus of E3 ubiquitin-protein ligase Arkadia. Arkadia plays a role in embryonic development [ (PUBMED:11298452) ]. Proteins containing this domain also include protein C18orf25 from humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNF111_N