The domain within your query sequence starts at position 31 and ends at position 242; the E-value for the RNase_HII domain shown below is 7.1e-54.
LGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFV GWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETY QARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSG YPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTA
RNase_HII |
---|
PFAM accession number: | PF01351 |
---|---|
Interpro abstract (IPR024567): | Ribonuclease HII and HIII are endonucleases that specifically degrade the RNA of RNA-DNA hybrids. Proteins which belong to this family have been found in bacteria, archaea, and eukaryota. The domain represented by this entry is found in ribonucleases HII. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_HII