The domain within your query sequence starts at position 8 and ends at position 109; the E-value for the RNase_P_Rpp14 domain shown below is 1.8e-11.

RVVYKSPSEYHYMKVCLEFQEHGVGLNVAQFKQLLVSALRDLFGEVGAALPVDVLTYDEK
TLSAILRICSSGLVKLWSSLTLFGAYKSKKCAFRVIQVSPFL

RNase_P_Rpp14

RNase_P_Rpp14
PFAM accession number:PF01900
Interpro abstract (IPR002759):

This family contains proteins found in some eukaryotes and archaebacteria that are related to yeast ribonuclease P. This enzyme is essential for tRNA processing generating 5'-termini of mature tRNA molecules [(PUBMED:7731988)]. tRNA processing enzyme ribonuclease P (RNase P) consists of an RNA molecule associated with at least eight protein subunits, hPop1, Rpp14, Rpp20, Rpp25, Rpp29, Rpp30, Rpp38, and Rpp40 [(PUBMED:10024167)].

GO process:tRNA processing (GO:0008033)
GO function:ribonuclease activity (GO:0004540)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_P_Rpp14