The domain within your query sequence starts at position 21 and ends at position 160; the E-value for the RNase_T domain shown below is 1.2e-13.

ASGNPGGSRLIEFPAVLLNTATGEIESEFHAYVQPQEHPILSEFCTELTGIKQVQVDEGV
PLKICLSQFCKWIHKLQQQQTISFAAGDSEPSTSEVKLCAFVTWSDWDLGVCLEYECRRK
QLLKPVFLNSWIDLRATYRA

RNase_T

RNase_T
PFAM accession number:PF00929
Interpro abstract (IPR013520): This entry includes a variety of exonuclease proteins, such as ribonuclease T [(PUBMED:8506149)] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_T