The domain within your query sequence starts at position 188 and ends at position 344; the E-value for the RNase_Zc3h12a domain shown below is 4.9e-65.

NLRPIVIDGSNVAMSHGNKEEFSCRGIQLAVDWFLDKGHKDITVFVPAWRKEQSRPDAPI
TDQDILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFDSDGIIVSNDNYRDLQVEK
PEWKKFIEERLLMYSFVNDKFMPPDDPLGRHGPSLEN

RNase_Zc3h12a

RNase_Zc3h12a
PFAM accession number:PF11977
Interpro abstract (IPR021869):

This domain is found in the Zc3h12a protein which has shown to be a ribonuclease that controls the stability of a set of inflammatory genes [ (PUBMED:19322177) ]. It has been suggested that this domain belongs to the PIN domain superfamily [ (PUBMED:19322177) ]. This domain has also been identified as part of the NYN domain family [ (PUBMED:17114934) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_Zc3h12a