The domain within your query sequence starts at position 540 and ends at position 631; the E-value for the RPAP3_C domain shown below is 3.8e-26.
VPANSFQLESDFRQLRSSPEMLYQYVKNIEPSLYPKLFQKNLDPDVFNQIIKILHDFYIE REKPALIFEVLERLSQLRRFDMAVMFMSGPER
RPAP3_C |
![]() |
---|
PFAM accession number: | PF13877 |
---|---|
Interpro abstract (IPR025986): | This domain is found at the C terminus of the RNA-polymerase II-associated protein 3 (RPAP3). RPAP3 binds to Monad and is involved in regulating apoptosis [ (PUBMED:18538670) ]. This domain represents the potential Monad-binding region of RPAP3. RPAP3 contains TPR-repeats towards the N terminus. This domain is also found in other proteins with TPR-repeats at the N terminus, like sperm-associated antigen 1 [ (PUBMED:11517287) ], and in proteins without TPR-repeats. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPAP3_C