The domain within your query sequence starts at position 98 and ends at position 188; the E-value for the RPAP3_C domain shown below is 1.2e-19.

QPTTSAEFYRDWRRHLRSGPERYQALLQLGGPKLGHLFQMDVGFGLLGELLVALAEHARL
SDRTAVLGILHSLANTGRFNLNLSLLSHAER

RPAP3_C

RPAP3_C
PFAM accession number:PF13877
Interpro abstract (IPR025986):

This domain is found at the C terminus of the RNA-polymerase II-associated protein 3 (RPAP3). RPAP3 binds to Monad and is involved in regulating apoptosis [(PUBMED:18538670)]. This domain represents the potential Monad-binding region of RPAP3. RPAP3 contains TPR-repeats towards the N terminus. This domain is also found in other proteins with TPR-repeats at the N terminus, like sperm-associated antigen 1 [(PUBMED:11517287)], and in proteins without TPR-repeats.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPAP3_C