The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the RPA_C domain shown below is 3.6e-17.

SQASAGRPSMSNPGMSEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQ
LQHMPVPSIK

RPA_C

RPA_C
PFAM accession number:PF08784
Interpro abstract (IPR014892):

This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A). RPA is involved in many DNA metabolic pathways including DNA replication, DNA repair, recombination, cell cycle and DNA damage checkpoints.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_C