The domain within your query sequence starts at position 58 and ends at position 128; the E-value for the RPA_interact_M domain shown below is 5.1e-16.
RLLVQEVMEEEWASLQSVENCPEALLQLELPLDLAVLQDIEQELCNEEKSIISEYEEDLE FDESCLRRMLA
RPA_interact_M |
---|
PFAM accession number: | PF14767 |
---|---|
Interpro abstract (IPR028155): | This entry represents the middle domain of replication protein A (RPA) interacting protein. RPA interacting protein is involved in the import of RPA into the nucleus. This domain is responsible for interaction with RPA [ (PUBMED:10428972) (PUBMED:16135809) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_M