The domain within your query sequence starts at position 58 and ends at position 128; the E-value for the RPA_interact_M domain shown below is 5.3e-16.

RLLVQEVMEEEWASLQSVENCPEALLQLELPLDLAVLQDIEQELCNEEKSIISEYEEDLE
FDESCLRRMLA

RPA_interact_M

RPA_interact_M
PFAM accession number:PF14767
Interpro abstract (IPR028155):

This entry represents the middle domain of replication protein A (RPA) interacting protein. RPA interacting protein is involved in the import of RPA into the nucleus. This domain is responsible for interaction with RPA [(PUBMED:10428972), (PUBMED:16135809)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_M