The domain within your query sequence starts at position 7 and ends at position 48; the E-value for the RPA_interact_N domain shown below is 1e-23.
SPHRLLYKQVGSPHWKETFRQGCLERMRNSRHRLLNKYRQAA
RPA_interact_N |
---|
PFAM accession number: | PF14766 |
---|---|
Interpro abstract (IPR028158): | This entry represents the N-terminal domain of replication protein A (RPA) interacting protein. RPA is a single stranded DNA-binding protein involved in DNA replication, repair, and recombination [ (PUBMED:19192389) ]. RPA interacting protein is involved in the import of RPA into the nucleus [ (PUBMED:10428972) (PUBMED:16135809) ]. The N-terminal domain is is rich in basic residues and responsible for interaction with importin beta [ (PUBMED:10428972) (PUBMED:16135809) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_N