The domain within your query sequence starts at position 7 and ends at position 48; the E-value for the RPA_interact_N domain shown below is 2.7e-23.

SPHRLLYKQVGSPHWKETFRQGCLERMRNSRHRLLNKYRQAA

RPA_interact_N

RPA_interact_N
PFAM accession number:PF14766
Interpro abstract (IPR028158):

This entry represents the N-terminal domain of replication protein A (RPA) interacting protein. RPA is a single stranded DNA-binding protein involved in DNA replication, repair, and recombination [(PUBMED:19192389)]. RPA interacting protein is involved in the import of RPA into the nucleus [(PUBMED:10428972), (PUBMED:16135809)]. The N-terminal domain is is rich in basic residues and responsible for interaction with importin beta [(PUBMED:10428972), (PUBMED:16135809)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_N