The domain within your query sequence starts at position 170 and ends at position 283; the E-value for the RPN13_C domain shown below is 7.5e-38.

QSILATMNVPAWPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADES
QNTLTSPQFQQALGMFSAALASGQLGPLMSQFGLPAEAVEAANKGDVEAFAKAM

RPN13_C

RPN13_C
PFAM accession number:PF16550
Interpro abstract (IPR032368):

This entry represents an all-helical domain that forms the binding-surface for the proteasome-ubiquitn-receptor protein Rpn13 to UCH37, one of the three de-ubiquitinating enzymes of the proteasome [(PUBMED:16906146), (PUBMED:20471946)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPN13_C