The domain within your query sequence starts at position 826 and ends at position 870; the E-value for the RRM_1 domain shown below is 8.5e-6.

ILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTESLQCAVS

RRM_1

RRM_1
PFAM accession number:PF00076
Interpro abstract (IPR000504):

Many eukaryotic proteins containing one or more copies of a putative RNA-binding domain of about 90 amino acids are known to bind single-stranded RNAs [(PUBMED:3072706), (PUBMED:3192525), (PUBMED:3313012)]. The largest group of single strand RNA-binding proteins is the eukaryotic RNA recognition motif (RRM) family that contains an eight amino acid RNP-1 consensus sequence [(PUBMED:2470643), (PUBMED:2467746)]. RRM proteins have a variety of RNA binding preferences and functions, and include heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing (SR, U2AF, Sxl), protein components of small nuclear ribonucleoproteins (U1 and U2 snRNPs), and proteins that regulate RNA stability and translation (PABP, La, Hu) [(PUBMED:3192525), (PUBMED:3313012), (PUBMED:2467746)]. The RRM in heterodimeric splicing factor U2 snRNP auxiliary factor (U2AF) appears to have two RRM-like domains with specialised features for protein recognition [(PUBMED:15231733)]. The motif also appears in a few single stranded DNA binding proteins.

The typical RRM consists of four anti-parallel beta-strands and two alpha-helices arranged in a beta-alpha-beta-beta-alpha-beta fold with side chains that stack with RNA bases. Specificity of RNA binding is determined by multiple contacts with surrounding amino acids. A third helix is present during RNA binding in some cases [(PUBMED:8290338)]. The RRM is reviewed in a number of publications [(PUBMED:1716386), (PUBMED:15853797), (PUBMED:16387655)].

GO function:nucleic acid binding (GO:0003676)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRM_1