The domain within your query sequence starts at position 230 and ends at position 333; the E-value for the RRM_3 domain shown below is 2.2e-32.

GCLLKFSGDLDDQTCREDLHFLFSNHGEIKWVDFARGAKEGIILFKEKAKEALEKARNAN
NGNLLLRNKKVTWKVLEGHAEKEALKKITDDQQESLNKWKSKGG

RRM_3

RRM_3
PFAM accession number:PF08777
Interpro abstract (IPR014886):

This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation. It contains a five stranded beta sheet which forms an atypical RNA recognition motif [(PUBMED:12842046)].

GO function:RNA binding (GO:0003723)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRM_3