The domain within your query sequence starts at position 46 and ends at position 584; the E-value for the RRN3 domain shown below is 7.5e-138.

KTVRFGGTVTEVLLKYKKGETNDLELLKNQLSDPDIKDDQIINWLLEFRSSVMYLTKDFE
QLINIILRLPWLNRSQRVVEEYLAFLGNLVSAQTVFLRPCLSMIASHFVPPRVIVKEGGI
DVSDSDDEDDNLPAIFDTCHRALQIITRYVPSTPWFLMPILVEKFPFVRKSERTLECYVH
NLLRISLYFPTLRREILELVIEKLLKLDVSVSRQDIEDAEEKAAQTCGGTDTTEGLFNMD
EDEDTDPEKKADQEQPNQMAHPTAERLDVLLCLLLSYIEDVCRVHGKIDNNKTKDLYRDL
ISIFDKLLLPTHASCHVQFFMFFLCSFKLGFAEAFLEHLWKKLQDPNNPAIIRQAAANYI
GSFLARAKFIPLITVKTCLDLLVNWLHMYLTNQDSGTKAFCDVALHGPFYSACQAVFYTV
VFRHKQLLSGNLKQGLQYLQSLNFERIVLSQLNPLKICLPQVVNFFAAITNKYQLVFCYT
IMERNSRQMLPVIRSTAGGDSVQTCTNPLDTFFPFDPCVLKRSKKFIDPIYQIWEDGSA

RRN3

RRN3
PFAM accession number:PF05327
Interpro abstract (IPR007991):

This family consists of several eukaryotic proteins which are homologous to the Saccharomyces cerevisiae RRN3 protein. RRN3 is one of the RRN genes specifically required for the transcription of rDNA by RNA polymerase I (Pol I) in the S. cerevisiae [(PUBMED:8670901)] RNA polymerase I complex within the nucleolus. In mammalian cells, the phosphorylation state of Rrn3 regulates rDNA transcription by determining the steady-state concentration of the Rrn3 [(PUBMED:12015311)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRN3