SMART: Pfam domain RRP7

The domain within your query sequence starts at position 151 and ends at position 280; the E-value for the RRP7 domain shown below is 8.3e-43.

GIHKWISDYEDSVLDPEALRMEVDAFMEAYDKKIAEEEAKAKEEEGVPDEEGWVKVTRRG
RRPVLPRTEAASLRVLEKEKRKRARKELLNFYAWQHRETKMEHLAQLRKKFEEDKQRIEL
MRAQRKFRPY

RRP7

PFAM accession number:	PF12923
Interpro abstract (IPR024326):	Ribosomal RNA-processing protein 7 (RRP7) is an essential protein in yeast that is involved in pre-rRNA processing and ribosome assembly [ (PUBMED:9271380) ]. It is speculated to be required for correct assembly of rpS27 into the pre-ribosomal particle [ (PUBMED:9271380) (PUBMED:17515605) ]. This entry represents the C-terminal domain of RRP7.

PFAM accession number:

PF12923

Interpro abstract (IPR024326):

Ribosomal RNA-processing protein 7 (RRP7) is an essential protein in yeast that is involved in pre-rRNA processing and ribosome assembly [ (PUBMED:9271380) ]. It is speculated to be required for correct assembly of rpS27 into the pre-ribosomal particle [ (PUBMED:9271380) (PUBMED:17515605) ].

This entry represents the C-terminal domain of RRP7.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RRP7