The domain within your query sequence starts at position 4332 and ends at position 4598; the E-value for the RR_TM4-6 domain shown below is 5.7e-96.
NMPDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYK LIPHNPNAGLSDLMTNPVPVPEVQEKFQEQKAKEEKEEKEETKSEPEKAEGEDGEKEEKA KDEKSKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAI NFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVLEESSGYMEPTL RILAILHTIISFFCIIGYYCLKVPLVI
RR_TM4-6 |
---|
PFAM accession number: | PF06459 |
---|---|
Interpro abstract (IPR009460): | The release of Ca 2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca 2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca 2+ release occurs through large, high-conductance Ca 2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity [ (PUBMED:15110152) ]. This region covers TM regions 4-6 of the ryanodine receptor 1 family. |
GO process: | cellular calcium ion homeostasis (GO:0006874) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | ryanodine-sensitive calcium-release channel activity (GO:0005219) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RR_TM4-6