The domain within your query sequence starts at position 4227 and ends at position 4497; the E-value for the RR_TM4-6 domain shown below is 4.7e-96.

DMPDPTQFGIHDDVIETDRAEVTEPGVTTELVHFVKGEAGDTDIMSDLFGIHSKKEGGLK
QGPEVGLGDLSEIIGKDEPPTLESTVRKKRKAQAAEMKAVHEAEGKAESEKADMEDREKE
DKIKEEGQTDYLWADVTVKKTRRRGQKAEKPEAFMANFFKGLEIYQTKLLHYLARNFYNL
RFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDDDEEEAMVFFVLQESTGYM
APTLRALAIVHTIISLVCVVGYYCLKVPLVV

RR_TM4-6

RR_TM4-6
PFAM accession number:PF06459
Interpro abstract (IPR009460):

The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity [(PUBMED:15110152)].

This region covers TM regions 4-6 of the ryanodine receptor 1 family.

GO process:cellular calcium ion homeostasis (GO:0006874)
GO component:integral component of membrane (GO:0016021)
GO function:ryanodine-sensitive calcium-release channel activity (GO:0005219)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RR_TM4-6