The domain within your query sequence starts at position 349 and ends at position 692; the E-value for the RSN1_7TM domain shown below is 1.5e-87.

AFVTFREKSMATYILKDFNACKCQGLRCKGEPQPSSYSRELCVSKWTVTFASYPEDICWK
NLSIQGVRWWLQWLGINFSLFVVLFFLTTPSIIMSTMDKFNVTKPIHALNNPVISQFFPT
LLLWSFSALLPSIVYYSTLLESHWTRSGENRIMVSKVYIFLIFMVLILPSLGLTSLDFFF
RWLFDKTSSETSIRLECVFLPDQGAFFVNYVIASAFIGSGMELLRLPGLILYTFRMIMAK
TAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHN
LYFAYLPAKLEKRIHFAAVNQALAAPILCLFWLFFFSFLRLGLT

RSN1_7TM

RSN1_7TM
PFAM accession number:PF02714
Interpro abstract (IPR003864): This entry represents the seven transmembrane domain region of putative phosphate transporter [(PUBMED:17005914), (PUBMED:18552845)]. This domain is found in eukaryotic transmembrane proteins that are involved in diverse functions, including phosphate metabolism (Q12252) [(PUBMED:11102525)] and spore wall assembly (Q07798) [(PUBMED:15590821)].
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RSN1_7TM