The domain within your query sequence starts at position 35 and ends at position 204; the E-value for the RSN1_TM domain shown below is 1.6e-20.

GIPTVLVLNIILWVFVVLLYSFLRKAAWDYGRLALLIHNDSLTSLIYGEQSEKSSPSEVS
LEAERRDRGFSSWFFNSLTMRDRDLINKCGDDARIYITFQYHLIIFVLILCIPSLGIILP
VNYIGTVLDWNSHFGRTTIVNVSTESKFLWLHSLFAFLYFLINLAFMGHH

RSN1_TM

RSN1_TM
PFAM accession number:PF13967
Interpro abstract (IPR032880):

This entry represents the first three transmembrane regions of calcium permeable stress-gated cation channel 1 (Csc1). Csc1 is a cation channel that is permeable to calcium and gated by physical signals such as hyperosmotic stress [(PUBMED:24503647)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RSN1_TM